Fine Chemistry
$11.05 – $1,794.35
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
Exendin derivative 1?HAEGTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS
$1,495.98
This product has multiple variants. The options may be chosen on the product page
Bioactive Small Molecules
$586.50
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$1,403.37
This product has multiple variants. The options may be chosen on the product page
Enzyme Inhibitors
$732.72
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$26.63 – $534.37
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$44.48 – $430.67
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$41.65 – $322.43
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$105.40 – $408.85
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$9.92 – $1,274.72
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$15.30 – $445.97
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$306.00 – $1,090.55
This product has multiple variants. The options may be chosen on the product page