Fine Chemistry
$701.25
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$508.32
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$306.00 – $2,719.98
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$628.98
This product has multiple variants. The options may be chosen on the product page
$1,064.22
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
GLP-1(7-36)?Human GLP-1-(7-36)-amide?Insulinotropin?MKC253?Glucagon-like Peptide 1 (7-36) amide
$64.62
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$4,757.43
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
GLP-2(1-33)(human)?GLP-2 (human)?Glucagon-like peptide 2 (human)?HADGSFSDEMNTILDNLAARDFINWLIQTKITD
$2,749.77
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$158.97 – $1,244.40
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$124.08
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$1,399.95 – $3,909.15
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$3,634.62
This product has multiple variants. The options may be chosen on the product page