Weight | 2816.28 kg |
---|---|
Purity | BR |
Pack Size | 1mg |
Storage Condition | -20Degree Celsius |
Form |
$2,749.77
CAS Number
:223460-79-5
Molecular Formula
C126H207N37O34S
SKU: G860498
Categories: Fine Chemistry, Peptides Synthesis
Be the first to review “GLP-2(1-33)(human)?GLP-2 (human)?Glucagon-like peptide 2 (human)?HADGSFSDEMNTILDNLAARDFINWLIQTKITD” Cancel reply
No additional product information available.
Related products
chiral building blocks
(1R?2R)-N?N’-Bis(2-acetyl-3-oxo-2-butenylidene)-1?2-dimesitylethylenediaminato Cobalt(II)
$70.83 – $419.33
This product has multiple variants. The options may be chosen on the product page
chiral building blocks
$24.37 – $119.00
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$23.80 – $151.30
This product has multiple variants. The options may be chosen on the product page
Bioactive Small Molecules
$43.35 – $2,269.50
This product has multiple variants. The options may be chosen on the product page
Fine Chemistry
$705.50 – $1,771.40
This product has multiple variants. The options may be chosen on the product page
chiral building blocks
$18.13 – $679.43
This product has multiple variants. The options may be chosen on the product page
Amino AcidsAnd its derivatives
4-|tert|-Butyl N-[(tert-butoxy)carbonyl]-L-aspartate dicyclohexylamine salt
$25.50 – $253.30
This product has multiple variants. The options may be chosen on the product page
chiral building blocks
(-)-4?5-Bis[hydroxy(diphenyl)methyl]-2?2-dimethyl-1?3-dioxolane
$8.50 – $130.62
This product has multiple variants. The options may be chosen on the product page
Reviews
There are no reviews yet.